ATM Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-57867-25ul

Product Code. 18650467

Description

ATM Polyclonal specifically detects ATM in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: ATM
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: AT mutated, A-T mutated, AT1, ATA, ataxia telangiectasia mutated (includes complementation groups A, C and D), ataxia telangiectasia mutatedATD, ATC, ATDC, ATE, DKFZp781A0353, EC 2.7.11.1, MGC74674, serine-protein kinase ATM, TEL1, TEL1, telomere maintenance 1, homolog, TELO1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ATM
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LTIVEVLLYDPLFDWTMNPLKALYLQQRPEDETELHPTLNADDQECKRNLSDIDQSFNKVAERVLMRLQEKLKGVE
• Quantity: 25 μL
• Research Discipline: Apoptosis, Breast Cancer, Cancer, Cell Cycle and Replication, Checkpoint signaling, Chromatin Research, DNA Double Strand Break Repair, DNA Repair, Genes Sensitive to DNA Damaging Agents, Hypoxia, Modulation of DNA Pools, p53 Pathway, Tumor Suppressors
• Gene ID (Entrez): 472
• Target Species: Human
• Isotype: IgG

For Research Use Only