missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ATM Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£240.00 - £386.00
Specifications
| Antigen | ATM |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18226445
|
Novus Biologicals
NBP2-57867 |
100 μL |
£386.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18650467
|
Novus Biologicals
NBP2-57867-25ul |
25 μL |
£240.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ATM Polyclonal specifically detects ATM in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| ATM | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Breast Cancer, Cancer, Cell Cycle and Replication, Checkpoint signaling, Chromatin Research, DNA Double Strand Break Repair, DNA Repair, Genes Sensitive to DNA Damaging Agents, Hypoxia, Modulation of DNA Pools, p53 Pathway, Tumor Suppressors | |
| AT mutated, A-T mutated, AT1, ATA, ataxia telangiectasia mutated (includes complementation groups A, C and D), ataxia telangiectasia mutatedATD, ATC, ATDC, ATE, DKFZp781A0353, EC 2.7.11.1, MGC74674, serine-protein kinase ATM, TEL1, TEL1, telomere maintenance 1, homolog, TELO1 | |
| ATM | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 472 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LTIVEVLLYDPLFDWTMNPLKALYLQQRPEDETELHPTLNADDQECKRNLSDIDQSFNKVAERVLMRLQEKLKGVE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title