missing translation for 'onlineSavingsMsg'
Learn More

ATG7 Rabbit anti-Human, Mouse, Rat, Clone: 3X1W4, Novus Biologicals™

Rabbit Monoclonal Antibody

£158.00 - £397.00

Specifications

Antigen	ATG7
Clone	3X1W4
Dilution	Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin, Knockout Validated
Applications	Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), KnockDown
Classification	Monoclonal

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18387835 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP3-15808-20UL	20 μg	£158.00 20µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

18048455 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP3-15808-100UL	100 μg	£397.00 100µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

ATG7 Monoclonal antibody specifically detects ATG7 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), KnockDown

Specifications

Antigen	ATG7
Dilution	Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin, Knockout Validated
Classification	Monoclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human, Mouse, Rat
Gene Alias	APG7 autophagy 7-like (S. cerevisiae), APG7L, APG7-LIKE, ATG12-activating enzyme E1 ATG7, ATG7 autophagy related 7 homolog (S. cerevisiae), Autophagy-related protein 7, DKFZp434N0735, GSA7, hAGP7, ubiquitin activating enzyme E1-like protein, Ubiquitin-activating enzyme E1-like protein, ubiquitin-like modifier-activating enzyme ATG7
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Atg7(Apg7) (O95352). MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTAD
Primary or Secondary	Primary
Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.

Clone	3X1W4
Applications	Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), KnockDown
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Autophagy
Formulation	PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene ID (Entrez)	10533
Isotype	IgG
Purification Method	Affinity purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

ATG7 Rabbit anti-Human, Mouse, Rat, Clone: 3X1W4, Novus Biologicals™

Specifications

Description

Specifications

Documents