missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ATG7 Rabbit anti-Human, Mouse, Rat, Clone: 3X1W4, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-15808-20UL
This item is not returnable.
View return policy
Description
ATG7 Monoclonal antibody specifically detects ATG7 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), KnockDown
Specifications
| ATG7 | |
| Monoclonal | |
| Unconjugated | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), KnockDown | |
| 3X1W4 | |
| Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin, Knockout Validated | |
| APG7 autophagy 7-like (S. cerevisiae), APG7L, APG7-LIKE, ATG12-activating enzyme E1 ATG7, ATG7 autophagy related 7 homolog (S. cerevisiae), Autophagy-related protein 7, DKFZp434N0735, GSA7, hAGP7, ubiquitin activating enzyme E1-like protein, Ubiquitin-activating enzyme E1-like protein, ubiquitin-like modifier-activating enzyme ATG7 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Atg7(Apg7) (O95352). MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTAD | |
| 20 μg | |
| Autophagy | |
| 10533 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction