missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ATG7 Rabbit anti-Human, Mouse, Rat, Clone: 3X1W4, Novus Biologicals™

ATG7 Rabbit anti-Human, Mouse, Rat, Clone: 3X1W4, Novus Biologicals™

Product Code. 18387835 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18387835 20 μg 20µL
18048455 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18387835 Supplier Novus Biologicals Supplier No. NBP31580820UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

ATG7 Monoclonal antibody specifically detects ATG7 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), KnockDown
TRUSTED_SUSTAINABILITY

Specifications

Antigen ATG7
Applications Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), KnockDown
Classification Monoclonal
Clone 3X1W4
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin, Knockout Validated
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias APG7 autophagy 7-like (S. cerevisiae), APG7L, APG7-LIKE, ATG12-activating enzyme E1 ATG7, ATG7 autophagy related 7 homolog (S. cerevisiae), Autophagy-related protein 7, DKFZp434N0735, GSA7, hAGP7, ubiquitin activating enzyme E1-like protein, Ubiquitin-activating enzyme E1-like protein, ubiquitin-like modifier-activating enzyme ATG7
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Atg7(Apg7) (O95352). MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTAD
Purification Method Affinity purified
Quantity 20 μg
Regulatory Status RUO
Research Discipline Autophagy
Primary or Secondary Primary
Gene ID (Entrez) 10533
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.