missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ATF6 beta Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£181.00 - £364.00
Specifications
| Antigen | ATF6 beta |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
ATF6 beta Polyclonal antibody specifically detects ATF6 beta in Mouse, Rat samples. It is validated for Western BlotSpecifications
| ATF6 beta | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse, Rat | |
| activating transcription factor 6 betacAMP-dependent transcription factor ATF-6 beta, ATF6-beta, cAMP response element-binding protein-related protein, cAMP responsive element binding protein-like 1, CREBL1CREB-RP, Creb-related protein, Creb-rp, cyclic AMP-dependent transcription factor ATF-6 beta, FLJ10066, G13cAMP-responsive element-binding protein-like 1, Protein G13 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human ATF6 beta (Q99941). MAELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDGSSLDVGMDVS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS with 50% glycerol, pH7.3. | |
| 1388 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title