ATF6 beta Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-92340-0.1ml

Product Code. 18617230

Description

ATF6 beta Polyclonal antibody specifically detects ATF6 beta in Mouse, Rat samples. It is validated for Western Blot

Specifications

• Antigen: ATF6 beta
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000
• Gene Alias: activating transcription factor 6 betacAMP-dependent transcription factor ATF-6 beta, ATF6-beta, cAMP response element-binding protein-related protein, cAMP responsive element binding protein-like 1, CREBL1CREB-RP, Creb-related protein, Creb-rp, cyclic AMP-dependent transcription factor ATF-6 beta, FLJ10066, G13cAMP-responsive element-binding protein-like 1, Protein G13
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human ATF6 beta (Q99941). MAELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDGSSLDVGMDVS
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Target Species: Mouse, Rat
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with 50% glycerol, pH7.3.
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1388
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG