missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Aspartate beta hydroxylase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£383.00
Specifications
| Antigen | Aspartate beta hydroxylase |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Aspartate beta hydroxylase Polyclonal specifically detects Aspartate beta hydroxylase in Human samples. It is validated for Western Blot.Specifications
| Aspartate beta hydroxylase | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| 444 | |
| Synthetic peptides corresponding to ASPH(aspartate beta-hydroxylase) The peptide sequence was selected from the N terminal of ASPH. Peptide sequence MAEDKETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSVAVVWFDLVD. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| AAH, ASP beta-hydroxylase, aspartate beta-hydroxylaseA beta H-J-J, aspartyl/asparaginyl-beta-hydroxylase, BAH, cardiac junctin, CASQ2BP1, EC 1.14.11.16, HAAHaspartyl/asparaginyl beta-hydroxylase, humbug, JCTN, junctate, junctin, Peptide-aspartate beta-dioxygenase | |
| ASPH | |
| IgG | |
| 25 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title