Aspartate beta hydroxylase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-69229

Product Code. 18058113

Description

Aspartate beta hydroxylase Polyclonal specifically detects Aspartate beta hydroxylase in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Aspartate beta hydroxylase
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: ASPH
• Immunogen: Synthetic peptides corresponding to ASPH(aspartate beta-hydroxylase) The peptide sequence was selected from the N terminal of ASPH. Peptide sequence MAEDKETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSVAVVWFDLVD.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Porcine: 86%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: AAH, ASP beta-hydroxylase, aspartate beta-hydroxylaseA beta H-J-J, aspartyl/asparaginyl-beta-hydroxylase, BAH, cardiac junctin, CASQ2BP1, EC 1.14.11.16, HAAHaspartyl/asparaginyl beta-hydroxylase, humbug, JCTN, junctate, junctin, Peptide-aspartate beta-dioxygenase
• Host Species: Rabbit
• Molecular Weight of Antigen: 25 kDa
• Quantity: 100 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 444
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.