missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ASB8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£390.00
Specifications
| Antigen | ASB8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ASB8 Polyclonal specifically detects ASB8 in Human samples. It is validated for Western Blot.Specifications
| ASB8 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| ankyrin repeat and SOCS box containing 8, ankyrin repeat and SOCS box protein 8, ankyrin repeat and SOCS box-containing 8, ASB-8, FLJ21255, MGC5540 | |
| ASB8 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9H765 | |
| 140461 | |
| Synthetic peptides corresponding to ASB8(ankyrin repeat and SOCS box-containing 8) The peptide sequence was selected from the N terminal of ASB8. Peptide sequence MSSSMWYIMQSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRGGADVNCT. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title