ASB8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-58904

Product Code. 18281114

Description

ASB8 Polyclonal specifically detects ASB8 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ASB8
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ankyrin repeat and SOCS box containing 8, ankyrin repeat and SOCS box protein 8, ankyrin repeat and SOCS box-containing 8, ASB-8, FLJ21255, MGC5540
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%; Chicken: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9H765
• Gene Symbols: ASB8
• Immunogen: Synthetic peptides corresponding to ASB8(ankyrin repeat and SOCS box-containing 8) The peptide sequence was selected from the N terminal of ASB8. Peptide sequence MSSSMWYIMQSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRGGADVNCT.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 140461
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.