missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ART1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ART1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ART1 Polyclonal specifically detects ART1 in Human samples. It is validated for Western Blot.Specifications
| ART1 | |
| Polyclonal | |
| Rabbit | |
| P52961 | |
| 417 | |
| Synthetic peptide directed towards the C terminal of human ART1The immunogen for this antibody is ART1 (NP_004305). Peptide Sequence: KHSTYNCEYIKDKKCKSGPCHLDNSAMGQSPLSAVWSLLLLLWFLVVRAF | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ADP-ribosyltransferase 1, ADP-ribosyltransferase 2, CD296, GPI-linked NAD(P)(+)--arginine ADP-ribosyltransferase 1, MGC133217, mono(ADP-ribosyl)transferase 1, RT6 | |
| ART1 | |
| IgG | |
| 36 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title