ART1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-79795

Product Code. 18277305

Description

ART1 Polyclonal specifically detects ART1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ART1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ADP-ribosyltransferase 1, ADP-ribosyltransferase 2, CD296, GPI-linked NAD(P)(+)--arginine ADP-ribosyltransferase 1, MGC133217, mono(ADP-ribosyl)transferase 1, RT6
• Host Species: Rabbit
• Molecular Weight of Antigen: 36 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 86%; Dog: 85%; Mouse: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P52961
• Gene Symbols: ART1
• Immunogen: Synthetic peptide directed towards the C terminal of human ART1The immunogen for this antibody is ART1 (NP_004305). Peptide Sequence: KHSTYNCEYIKDKKCKSGPCHLDNSAMGQSPLSAVWSLLLLLWFLVVRAF
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 417
• Reconstitution: Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.