missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ARMC8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ARMC8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ARMC8 Polyclonal specifically detects ARMC8 in Human samples. It is validated for Western Blot.Specifications
| ARMC8 | |
| Polyclonal | |
| Rabbit | |
| armadillo repeat containing 8, armadillo repeat-containing protein 8, DKFZP434A043, HSPC056, MGC10058, MGC4880 | |
| ARMC8 | |
| IgG | |
| 43 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 25852 | |
| Synthetic peptides corresponding to ARMC8 (armadillo repeat containing 8) The peptide sequence was selected from the N terminal of ARMC8. Peptide sequence MEVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVP. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title