ARMC8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-69203

Product Code. 18278632

Description

ARMC8 Polyclonal specifically detects ARMC8 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ARMC8
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: ARMC8
• Immunogen: Synthetic peptides corresponding to ARMC8 (armadillo repeat containing 8) The peptide sequence was selected from the N terminal of ARMC8. Peptide sequence MEVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVP.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 25852
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: armadillo repeat containing 8, armadillo repeat-containing protein 8, DKFZP434A043, HSPC056, MGC10058, MGC4880
• Host Species: Rabbit
• Molecular Weight of Antigen: 43 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: yeast 82%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG