missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ARL8B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ARL8B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ARL8B Polyclonal specifically detects ARL8B in Human samples. It is validated for Western Blot.Specifications
| ARL8B | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| ADP-ribosylation factor-like 10C, ADP-ribosylation factor-like 8B, ADP-ribosylation factor-like protein 10C, ADP-ribosylation factor-like protein 8B, ARL10C, FLJ10702, Gie1, Novel small G protein indispensable for equal chromosome segregation 1 | |
| ARL8B | |
| IgG | |
| 22 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9NVJ2 | |
| 55207 | |
| Synthetic peptides corresponding to ARL8B(ADP-ribosylation factor-like 8B) The peptide sequence was selected from the middle region of ARL8B (NP_060654). Peptide sequence DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title