ARL8B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56544

Product Code. 18275271

Description

ARL8B Polyclonal specifically detects ARL8B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ARL8B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ADP-ribosylation factor-like 10C, ADP-ribosylation factor-like 8B, ADP-ribosylation factor-like protein 10C, ADP-ribosylation factor-like protein 8B, ARL10C, FLJ10702, Gie1, Novel small G protein indispensable for equal chromosome segregation 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 22 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 55207
• Reconstitution: Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NVJ2
• Gene Symbols: ARL8B
• Immunogen: Synthetic peptides corresponding to ARL8B(ADP-ribosylation factor-like 8B) The peptide sequence was selected from the middle region of ARL8B (NP_060654). Peptide sequence DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 92%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
• Isotype: IgG