missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ARHGEF19 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ARHGEF19 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ARHGEF19 Polyclonal specifically detects ARHGEF19 in Human samples. It is validated for Western Blot.Specifications
| ARHGEF19 | |
| Polyclonal | |
| Rabbit | |
| Q8IW93 | |
| 128272 | |
| Synthetic peptides corresponding to ARHGEF19 (Rho guanine nucleotide exchange factor (GEF) 19) The peptide sequence was selected from the middle region of ARHGEF19 (NP_694945). Peptide sequence: RFLLNSVLYQEYSDVASARELRRQQREEEGPGDEAEGAEEGPGPPRANLS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ephexin-2, FLJ33962, Rho guanine nucleotide exchange factor (GEF) 19, RP4-733M16.1, weakly similar to Rho GEF, WGEFrho guanine nucleotide exchange factor 19 | |
| ARHGEF19 | |
| IgG | |
| 89 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title