ARHGEF19 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57038

Product Code. 18261732

Description

ARHGEF19 Polyclonal specifically detects ARHGEF19 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ARHGEF19
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ephexin-2, FLJ33962, Rho guanine nucleotide exchange factor (GEF) 19, RP4-733M16.1, weakly similar to Rho GEF, WGEFrho guanine nucleotide exchange factor 19
• Host Species: Rabbit
• Molecular Weight of Antigen: 89 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Bovine: 92%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Equine
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8IW93
• Gene Symbols: ARHGEF19
• Immunogen: Synthetic peptides corresponding to ARHGEF19 (Rho guanine nucleotide exchange factor (GEF) 19) The peptide sequence was selected from the middle region of ARHGEF19 (NP_694945). Peptide sequence: RFLLNSVLYQEYSDVASARELRRQQREEEGPGDEAEGAEEGPGPPRANLS.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 128272
• Reconstitution: Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.