missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ARHGAP36 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | ARHGAP36 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ARHGAP36 Polyclonal specifically detects ARHGAP36 in Human samples. It is validated for Western Blot.Specifications
| ARHGAP36 | |
| Polyclonal | |
| Rabbit | |
| Q6ZRI8 | |
| 158763 | |
| Synthetic peptides corresponding to the N terminal of RP13 102H20. 1. Immunizing peptide sequence KPDRALPIDRPNTLDKWFLILRGQQRAVSHKTFGISLEEVLVNEFTRRKH. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ30058, Rho GTPase activating protein 36, rho GTPase-activating protein 36 | |
| ARHGAP36 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title