ARHGAP36 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-74250

Product Code. 18202635

Description

ARHGAP36 Polyclonal specifically detects ARHGAP36 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ARHGAP36
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ30058, Rho GTPase activating protein 36, rho GTPase-activating protein 36
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 158763
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q6ZRI8
• Gene Symbols: ARHGAP36
• Immunogen: Synthetic peptides corresponding to the N terminal of RP13 102H20. 1. Immunizing peptide sequence KPDRALPIDRPNTLDKWFLILRGQQRAVSHKTFGISLEEVLVNEFTRRKH.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 85%; Bordetella pertussis: 76%; Bordetella parapertussis: 76%; Alcaligenes bronchisepticus: 76%;.
• Target Species: Human, Mouse, Pig, Equine, Goat, Rabbit, Sheep
• Isotype: IgG