missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Argonaute 3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Argonaute 3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Argonaute 3 Polyclonal specifically detects Argonaute 3 in Human samples. It is validated for Western Blot.Specifications
| Argonaute 3 | |
| Polyclonal | |
| Rabbit | |
| B1ALI0 | |
| 192669 | |
| IgG | |
| 69 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| AGO3argonaute 3, argonaute3, eIF2C 3, eIF-2C 3, Eukaryotic translation initiation factor 2C 3, eukaryotic translation initiation factor 2C, 3, FLJ12765, hAgo3, MGC86946, protein argonaute-3 | |
| Synthetic peptides corresponding to EIF2C3(eukaryotic translation initiation factor 2C, 3) The peptide sequence was selected from the N terminal of EIF2C3. Peptide sequence MCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTMRRKYRVCN. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title