Argonaute 3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-54932

Product Code. 18219382

Description

Argonaute 3 Polyclonal specifically detects Argonaute 3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Argonaute 3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: AGO3argonaute 3, argonaute3, eIF2C 3, eIF-2C 3, Eukaryotic translation initiation factor 2C 3, eukaryotic translation initiation factor 2C, 3, FLJ12765, hAgo3, MGC86946, protein argonaute-3
• Host Species: Rabbit
• Molecular Weight of Antigen: 69 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Guinea pig: 85%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: B1ALI0
• Gene Symbols: AGO3
• Immunogen: Synthetic peptides corresponding to EIF2C3(eukaryotic translation initiation factor 2C, 3) The peptide sequence was selected from the N terminal of EIF2C3. Peptide sequence MCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTMRRKYRVCN.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 192669
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.