missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Argininosuccinate Lyase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | Argininosuccinate Lyase |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
Argininosuccinate Lyase Polyclonal specifically detects Argininosuccinate Lyase in Human samples. It is validated for Western Blot.Specifications
| Argininosuccinate Lyase | |
| Polyclonal | |
| Purified | |
| RUO | |
| 435 | |
| Synthetic peptides corresponding to ASL(argininosuccinate lyase) The peptide sequence was selected from the middle region of ASL. Peptide sequence LILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGREDK. | |
| Primary | |
| 49 kDa |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| argininosuccinase, argininosuccinate lyase, Arginosuccinase, ASAL, EC 4.3.2.1 | |
| ASL | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title