missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Argininosuccinate Lyase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-55125
This item is not returnable.
View return policy
Description
Argininosuccinate Lyase Polyclonal specifically detects Argininosuccinate Lyase in Human samples. It is validated for Western Blot.
Specifications
| Argininosuccinate Lyase | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| ASL | |
| Synthetic peptides corresponding to ASL(argininosuccinate lyase) The peptide sequence was selected from the middle region of ASL. Peptide sequence LILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGREDK. | |
| Protein A purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml | |
| argininosuccinase, argininosuccinate lyase, Arginosuccinase, ASAL, EC 4.3.2.1 | |
| Rabbit | |
| 49 kDa | |
| 100 μL | |
| metabolism | |
| 435 | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Yeast, Zebrafish | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction