missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Archaemetzincin 2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Archaemetzincin 2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Archaemetzincin 2 Polyclonal specifically detects Archaemetzincin 2 in Human samples. It is validated for Western Blot.Specifications
| Archaemetzincin 2 | |
| Polyclonal | |
| Rabbit | |
| NP_001028746 | |
| 51321 | |
| Synthetic peptide directed towards the C terminal of human AMZ2. Peptide sequence ACLMQGSNHLEEADRRPLNLCPICLHKLQCAVGFSIVERYKALVRWIDDE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| archaelysin family metallopeptidase 2, archaemetzincin-2, archaemetzincins-2, Archeobacterial metalloproteinase-like protein 2, EC 3.- | |
| AMZ2 | |
| IgG | |
| 33 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title