Archaemetzincin 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-79621

Product Code. 18250576

Description

Archaemetzincin 2 Polyclonal specifically detects Archaemetzincin 2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Archaemetzincin 2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: archaelysin family metallopeptidase 2, archaemetzincin-2, archaemetzincins-2, Archeobacterial metalloproteinase-like protein 2, EC 3.-
• Host Species: Rabbit
• Molecular Weight of Antigen: 33 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Pig: 100%; Mouse: 92%; Rat: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_001028746
• Gene Symbols: AMZ2
• Immunogen: Synthetic peptide directed towards the C terminal of human AMZ2. Peptide sequence ACLMQGSNHLEEADRRPLNLCPICLHKLQCAVGFSIVERYKALVRWIDDE.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51321
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.