Aquaporin-3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18472422	Novus Biologicals NBP2-33872-25ul	25 μL
18766283	Novus Biologicals NBP2-33872	0.1 mL

Description

Aquaporin-3 Polyclonal specifically detects Aquaporin-3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Aquaporin-3
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: Q92482
• Gene ID (Entrez): 360
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QLMIGCHLEQPPPSNEEENVKLAHVKHKEQI
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Membrane Trafficking and Chaperones
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: AQP-3, Aquaglyceroporin-3, aquaporin 3, aquaporin 3 (GIL blood group), aquaporin 3 (Gill blood group), aquaporin-3, GIL, Gill blood group
• Gene Symbols: AQP3
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only