missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Aquaporin-2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £460.00
Specifications
| Antigen | Aquaporin-2 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18488441
|
Novus Biologicals
NBP2-33472-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18175975
|
Novus Biologicals
NBP2-33472 |
0.1 mL |
£460.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Aquaporin-2 Polyclonal specifically detects Aquaporin-2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Aquaporin-2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P41181 | |
| 359 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VLFPPAKSLSERLAVLKGLEPDTDWEEREVRRRQSVELHSPQSL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Rabbit | |
| Plasma Membrane Markers, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ADH water channel, AQP-2, AQP-CD, aquaporin 2 (collecting duct), aquaporin-2, aquaporin-CD, Collecting duct water channel protein, MGC34501, Water channel protein for renal collecting duct, water-channel aquaporin 2, WCH-CD | |
| AQP2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title