Aquaporin-2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-33472-25ul

Artikelnummer. 18488441

Beschreibung

Aquaporin-2 Polyclonal specifically detects Aquaporin-2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Spezifikation

• Antigen: Aquaporin-2
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Accession No.: P41181
• Gene Symbols: AQP2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VLFPPAKSLSERLAVLKGLEPDTDWEEREVRRRQSVELHSPQSL
• Quantity: 25 μL
• Research Discipline: Plasma Membrane Markers, Signal Transduction
• Gene ID (Entrez): 359
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ADH water channel, AQP-2, AQP-CD, aquaporin 2 (collecting duct), aquaporin-2, aquaporin-CD, Collecting duct water channel protein, MGC34501, Water channel protein for renal collecting duct, water-channel aquaporin 2, WCH-CD
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only