APRIN Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-90122-25ul

Product Code. 18434062

Description

APRIN Polyclonal specifically detects APRIN in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: APRIN
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: Androgen-induced proliferation inhibitorKIAA0979androgen induced inhibitor of proliferation, Androgen-induced prostate proliferative shutoff-associated protein AS3, androgen-induced shutoff 3, AS3APRIN, CG008, FLJ23236, PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae), sister chromatid cohesion protein PDS5 homolog B
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PDS5B
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GSQRSRKRGHTASESDEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMKTSKKGSKKKSGPPAPEEEE
• Quantity: 25 μL
• Research Discipline: Apoptosis, Cell Cycle and Replication, DNA Repair
• Gene ID (Entrez): 23047
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only