missing translation for 'onlineSavingsMsg'
Learn More
Learn More
APR3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | APR3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
44289 Polyclonal specifically detects 44289 in Human samples. It is validated for Western Blot.Specifications
| APR3 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis | |
| apoptosis related protein 3, apoptosis related protein APR-3, apoptosis-related protein 3, APR3, APR-3, APR--3, chromosome 2 open reading frame 28, HSPC013, p18PRO240 | |
| ATRAID | |
| IgG | |
| 18 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_057169 | |
| 51374 | |
| Synthetic peptide directed towards the C terminal of human C2orf28. Peptide sequence VCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title