APPBP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-53085

Product Code. 18291812

Description

APPBP2 Polyclonal specifically detects APPBP2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: APPBP2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: amyloid beta precursor protein (cytoplasmic tail) binding protein 2, Amyloid beta precursor protein-binding protein 2, amyloid protein-binding protein 2, APP-BP2, KIAA0228HS.84084, PAT1amyloid beta precursor protein (cytoplasmic tail)-binding protein 2, Protein interacting with APP tail 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 67 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge vial prior to reconstitution. Add 50μL distilled watter to a final antibody concentration of 1mg/mL.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q92624
• Gene Symbols: APPBP2
• Immunogen: Synthetic peptides corresponding to Amyloid precursor protein (cytoplasmic tail) binding protein 2). The peptide sequence was selected from the middle region of Amyloid precursor protein (NP_006371). Peptide sequence: QASKACVVKREFKKAEQLIKHAVYLARDHFGSKHPKYSDTLLDYGFYLLN The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10513
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG