missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Apolipoprotein E R2/ApoE R2 Rabbit anti-Human, Mouse, Rat, Clone: 0V1R8, Novus Biologicals™
Rabbit Monoclonal Antibody
£150.00 - £387.00
Specifications
| Antigen | Apolipoprotein E R2/ApoE R2 |
|---|---|
| Clone | 0V1R8 |
| Dilution | Western Blot 1:500 - 1:2000 |
| Applications | Western Blot |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18319915
|
Novus Biologicals
NBP3-16872-20UL |
20 μg |
£150.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18063955
|
Novus Biologicals
NBP3-16872-100UL |
100 μg |
£387.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Apolipoprotein E R2/ApoE R2 Monoclonal antibody specifically detects Apolipoprotein E R2/ApoE R2 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| Apolipoprotein E R2/ApoE R2 | |
| Western Blot 1:500 - 1:2000 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| APOER2HSZ75190, Apolipoprotein E receptor 2, low density lipoprotein receptor-related protein 8, apolipoprotein e receptor, low-density lipoprotein receptor-related protein 8, LRP-8, MCI1 | |
| A synthetic peptide corresponding to a sequence within amino acids 864-963 of human Apolipoprotein E R2/ApoE R2 (Q14114). PVYRKTTEEEDEDELHIGRTAQIGHVYPAAISSFDRPLWAEPCLGETREPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKSKRVALSLEDDGLP | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| 0V1R8 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Alzheimers Research, Lipid and Metabolism, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Signal Transduction | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| 7804 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title