missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Apolipoprotein E R2/ApoE R2 Rabbit anti-Human, Mouse, Rat, Clone: 0V1R8, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-16872-20UL
This item is not returnable.
View return policy
Description
Apolipoprotein E R2/ApoE R2 Monoclonal antibody specifically detects Apolipoprotein E R2/ApoE R2 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| Apolipoprotein E R2/ApoE R2 | |
| Monoclonal | |
| Unconjugated | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot | |
| 0V1R8 | |
| Western Blot 1:500 - 1:2000 | |
| APOER2HSZ75190, Apolipoprotein E receptor 2, low density lipoprotein receptor-related protein 8, apolipoprotein e receptor, low-density lipoprotein receptor-related protein 8, LRP-8, MCI1 | |
| A synthetic peptide corresponding to a sequence within amino acids 864-963 of human Apolipoprotein E R2/ApoE R2 (Q14114). PVYRKTTEEEDEDELHIGRTAQIGHVYPAAISSFDRPLWAEPCLGETREPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKSKRVALSLEDDGLP | |
| 20 μg | |
| Alzheimers Research, Lipid and Metabolism, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Signal Transduction | |
| 7804 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido