missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
Apolipoprotein A-II/ApoA2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£415.00
Tekniske data
| Antigen | Apolipoprotein A-II/ApoA2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Beskrivelse
Apolipoprotein A-II/ApoA2 Polyclonal specifically detects Apolipoprotein A-II/ApoA2 in Human samples. It is validated for Western Blot.Tekniske data
| Apolipoprotein A-II/ApoA2 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Lipid and Metabolism | |
| APOA2, apoAII, Apo-AII, ApoA-II, Apolipoprotein A2, apolipoprotein A-II | |
| APOA2 | |
| IgG | |
| 9 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P02652 | |
| 336 | |
| Synthetic peptides corresponding to APOA2 (apolipoprotein A-II) The peptide sequence was selected from the N terminal of APOA2)(50ug). Peptide sequence MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME. | |
| Primary |
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel