Apolipoprotein A-II/ApoA2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57716

Product Code. 18280924

Description

Apolipoprotein A-II/ApoA2 Polyclonal specifically detects Apolipoprotein A-II/ApoA2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Apolipoprotein A-II/ApoA2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: APOA2, apoAII, Apo-AII, ApoA-II, Apolipoprotein A2, apolipoprotein A-II
• Host Species: Rabbit
• Molecular Weight of Antigen: 9 kDa
• Quantity: 100 μL
• Research Discipline: Cancer, Lipid and Metabolism
• Gene ID (Entrez): 336
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P02652
• Gene Symbols: APOA2
• Immunogen: Synthetic peptides corresponding to APOA2 (apolipoprotein A-II) The peptide sequence was selected from the N terminal of APOA2)(50ug). Peptide sequence MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Rabbit: 79%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG