missing translation for 'onlineSavingsMsg'
Learn More
Learn More
APOBEC3F Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-57515
This item is not returnable.
View return policy
Description
APOBEC3F Polyclonal specifically detects APOBEC3F in Human samples. It is validated for Western Blot.
Specifications
| APOBEC3F | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F, Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3F, ARP8, BK150C2.4.MRNA, DNA dC->dU-editing enzyme APOBEC-3F, EC 3.5.4, EC 3.5.4.-, induced upon T-cell activation, KA6, MGC74891 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 200316 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q8IUX4 | |
| APOBEC3F | |
| Synthetic peptides corresponding to APOBEC3F(apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F) The peptide sequence was selected from the C terminal of APOBEC3F. Peptide sequence ASVEIMGYKDFKYCWENFVYNDDEPFKPWKGLKYNFLFLDSKLQEILE The peptide sequence for this immunogen was taken from within the described region. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Human: 100%. | |
| Human, Pig | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction