APOBEC3F Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57513

Product Code. 18256403

Description

APOBEC3F Polyclonal specifically detects APOBEC3F in Human samples. It is validated for Western Blot.

Specifications

• Antigen: APOBEC3F
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F, Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3F, ARP8, BK150C2.4.MRNA, DNA dC->dU-editing enzyme APOBEC-3F, EC 3.5.4, EC 3.5.4.-, induced upon T-cell activation, KA6, MGC74891
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 200316
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8IUX4
• Gene Symbols: APOBEC3F
• Immunogen: Synthetic peptides corresponding to APOBEC3F(apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F) The peptide sequence was selected from the N terminal of APOBEC3F. Peptide sequence MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLD The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human, Pig
• Isotype: IgG