missing translation for 'onlineSavingsMsg'
Learn More
Learn More
APEG1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
£222.00 - £470.00
Specifications
| Antigen | APEG1 |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18451302
|
Novus Biologicals
NBP1-90134-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18268996
|
Novus Biologicals
NBP1-90134 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
APEG1 Polyclonal specifically detects APEG1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| APEG1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q15772 | |
| 10290 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:VYKSVIANKLGKAACYAHLYVTDVVPGPPDGAPQVVAVTGRMVTLTWNPPRSLDMAIDPDSLTYTVQHQV | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| aortic preferentially expressed gene 1, Aortic preferentially expressed protein 1, APEG1, BPEG, EC 2.7.11, EC 2.7.11.1, KIAA1297APEG-1, MGC12676, nuclear protein, marker for differentiated aortic smooth muscle anddown-regulated with vascular injury, SPEG complex locus, SPEGalpha, SPEGbeta, striated muscle preferentially expressed protein kinase | |
| SPEG | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title