missing translation for 'onlineSavingsMsg'
Learn More
Learn More
APEG1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP1-90134-25ul
This item is not returnable.
View return policy
Description
APEG1 Polyclonal specifically detects APEG1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| APEG1 | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Q15772 | |
| SPEG | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:VYKSVIANKLGKAACYAHLYVTDVVPGPPDGAPQVVAVTGRMVTLTWNPPRSLDMAIDPDSLTYTVQHQV | |
| 25 μL | |
| Cell Cycle and Replication | |
| 10290 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| aortic preferentially expressed gene 1, Aortic preferentially expressed protein 1, APEG1, BPEG, EC 2.7.11, EC 2.7.11.1, KIAA1297APEG-1, MGC12676, nuclear protein, marker for differentiated aortic smooth muscle anddown-regulated with vascular injury, SPEG complex locus, SPEGalpha, SPEGbeta, striated muscle preferentially expressed protein kinase | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction