AP1M2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18286181	Novus Biologicals NBP1-57035	100 μL

Description

AP1M2 Polyclonal specifically detects AP1M2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: AP1M2
• Classification: Polyclonal
• Host Species: Rabbit
• Gene Accession No.: Q9Y6Q5
• Gene ID (Entrez): 10053
• Immunogen: Synthetic peptides corresponding to AP1M2 (adaptor-related protein complex 1, mu 2 subunit) The peptide sequence was selected from the N terminal of AP1M2 (NP_005489). Peptide sequence: MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLL.
• Primary or Secondary: Primary
• Molecular Weight of Antigen: 48 kDa

• Applications: Western Blot
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Gene Alias: Adaptor protein complex AP-1 mu-2 subunit, Adaptor-related protein complex 1 mu-2 subunit, adaptor-related protein complex 1, mu 2 subunit, AP-1 complex subunit mu-2, AP1-mu2, AP-mu chain family member mu1B, Clathrin assembly protein complex 1 medium chain 2, clathrin coat assembly protein AP47 2, clathrin coat associated protein AP47 2, clathrin-associated adaptor medium chain mu2, golgi adaptor AP-1 47 kDa protein, Golgi adaptor HA1/AP1 adaptin mu-2 subunit, HA1 47 kDa subunit 2, HSMU1B, MU1B, MU-1B, mu1B-adaptin, mu2, Mu-adaptin 2
• Gene Symbols: AP1M2
• Isotype: IgG
• Test Specificity: This product is specific to Subunit or Isoform: mu-2.