missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ANKRD13D Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ANKRD13D |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ANKRD13D Polyclonal specifically detects ANKRD13D in Mouse samples. It is validated for Western Blot.Specifications
| ANKRD13D | |
| Polyclonal | |
| Rabbit | |
| NP_080996 | |
| 338692 | |
| Synthetic peptide directed towards the middle region of human Ankrd13dThe immunogen for this antibody is Ankrd13d. Peptide sequence RTEHLSDQDKLRNKGGKTPFQSFLGMAQQHSSHTLAPVQQAASPTNPTAI. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ankyrin repeat domain 13 family, member D, ankyrin repeat domain-containing protein 13D, MGC50828 | |
| ANKRD13D | |
| IgG | |
| 57 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title