missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ANKRD13D Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-79611
This item is not returnable.
View return policy
Description
ANKRD13D Polyclonal specifically detects ANKRD13D in Mouse samples. It is validated for Western Blot.
Specifications
| ANKRD13D | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| ankyrin repeat domain 13 family, member D, ankyrin repeat domain-containing protein 13D, MGC50828 | |
| Rabbit | |
| 57 kDa | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Mouse: 86%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Zebrafish | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_080996 | |
| ANKRD13D | |
| Synthetic peptide directed towards the middle region of human Ankrd13dThe immunogen for this antibody is Ankrd13d. Peptide sequence RTEHLSDQDKLRNKGGKTPFQSFLGMAQQHSSHTLAPVQQAASPTNPTAI. | |
| Affinity purified | |
| RUO | |
| 338692 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction