missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ANKMY2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | ANKMY2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ANKMY2 Polyclonal specifically detects ANKMY2 in Human samples. It is validated for Western Blot.Specifications
| ANKMY2 | |
| Polyclonal | |
| Rabbit | |
| Q8IV38 | |
| 57037 | |
| Synthetic peptides corresponding to ANKMY2(ankyrin repeat and MYND domain containing 2) Antibody(against the N terminal of ANKMY2 (NP_064715). Peptide sequence MVHIKKGELTQEEKELLEVIGKGTVQEAGTLLSSKNVRVNCLDENGMTPL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ankyrin repeat and MYND domain containing 2, ankyrin repeat and MYND domain-containing protein 2, DKFZP564O043, ZMYND20 | |
| ANKMY2 | |
| IgG | |
| 49 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title