ANKMY2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-55412

Product Code. 18275985

Description

ANKMY2 Polyclonal specifically detects ANKMY2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ANKMY2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ankyrin repeat and MYND domain containing 2, ankyrin repeat and MYND domain-containing protein 2, DKFZP564O043, ZMYND20
• Host Species: Rabbit
• Molecular Weight of Antigen: 49 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8IV38
• Gene Symbols: ANKMY2
• Immunogen: Synthetic peptides corresponding to ANKMY2(ankyrin repeat and MYND domain containing 2) Antibody(against the N terminal of ANKMY2 (NP_064715). Peptide sequence MVHIKKGELTQEEKELLEVIGKGTVQEAGTLLSSKNVRVNCLDENGMTPL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 57037
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Yeast
• Isotype: IgG