missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AMSH-LP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Applications | Western Blot |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
AMSH-LP Polyclonal specifically detects AMSH-LP in Human samples. It is validated for Western Blot.Specifications
| Western Blot | |
| Unconjugated | |
| RUO | |
| ALMalpha, AMSH-FP, AMSHLP, AMSH-LPassociated molecule with the SH3 domain of STAM (AMSH) - Family Protein, associated molecule with the SH3 domain of STAM (AMSH) like protein, bA399O19.2, EC 3.1.2.15, EC 3.4.19.-, FLJ31524, KIAA1373AMSH-like protease, STAM binding protein-like 1, STAM-binding protein-like 1 | |
| STAMBPL1 | |
| IgG |
| Polyclonal | |
| Rabbit | |
| Q96FJ0 | |
| 57559 | |
| Synthetic peptides corresponding to STAMBPL1(STAM binding protein-like 1) The peptide sequence was selected from the N terminal of STAMBPL1. Peptide sequence MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRR. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title