AMSH-LP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56334

Product Code. 18280655

Description

AMSH-LP Polyclonal specifically detects AMSH-LP in Human samples. It is validated for Western Blot.

Specifications

• Antigen: AMSH-LP
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ALMalpha, AMSH-FP, AMSHLP, AMSH-LPassociated molecule with the SH3 domain of STAM (AMSH) - Family Protein, associated molecule with the SH3 domain of STAM (AMSH) like protein, bA399O19.2, EC 3.1.2.15, EC 3.4.19.-, FLJ31524, KIAA1373AMSH-like protease, STAM binding protein-like 1, STAM-binding protein-like 1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Mouse: 100%; Pig: 100%; Xenopus: 92%; Bovine: 92%; Chicken: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96FJ0
• Gene Symbols: STAMBPL1
• Immunogen: Synthetic peptides corresponding to STAMBPL1(STAM binding protein-like 1) The peptide sequence was selected from the N terminal of STAMBPL1. Peptide sequence MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRR.
• Quantity: 100 μL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 57559
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.