missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AMPK beta 2/PRKAB2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | AMPK beta 2/PRKAB2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
AMPK beta 2/PRKAB2 Polyclonal specifically detects AMPK beta 2/PRKAB2 in Human, Mouse samples. It is validated for Western Blot.Specifications
| AMPK beta 2/PRKAB2 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| 5'-AMP-activated protein kinase, beta-2 subunit, AMPK beta 2,5'-AMP-activated protein kinase subunit beta-2, AMPK beta-2 chain, AMPK subunit beta-2, MGC61468, protein kinase, AMP-activated, beta 2 non-catalytic subunit | |
| PRKAB2 | |
| IgG | |
| 30 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| O43741 | |
| 5565 | |
| Synthetic peptides corresponding to PRKAB2(protein kinase, AMP-activated, beta 2 non-catalytic subunit) The peptide sequence was selected from the middle region of PRKAB2 (NP_005390). Peptide sequence RDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPA | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title