AMPK beta 2/PRKAB2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57581

Product Code. 18258502

Description

AMPK beta 2/PRKAB2 Polyclonal specifically detects AMPK beta 2/PRKAB2 in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: AMPK beta 2/PRKAB2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 5'-AMP-activated protein kinase, beta-2 subunit, AMPK beta 2,5'-AMP-activated protein kinase subunit beta-2, AMPK beta-2 chain, AMPK subunit beta-2, MGC61468, protein kinase, AMP-activated, beta 2 non-catalytic subunit
• Host Species: Rabbit
• Molecular Weight of Antigen: 30 kDa
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 5565
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O43741
• Gene Symbols: PRKAB2
• Immunogen: Synthetic peptides corresponding to PRKAB2(protein kinase, AMP-activated, beta 2 non-catalytic subunit) The peptide sequence was selected from the middle region of PRKAB2 (NP_005390). Peptide sequence RDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPA
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Equine: 100%; Human: 100%; Pig: 100%; Rat: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG