missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AMPK alpha 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£240.00 - £409.00
Specifications
| Antigen | AMPK alpha 1 |
|---|---|
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18605947
|
Novus Biologicals
NBP2-49430 |
0.1 mL |
£409.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18615228
|
Novus Biologicals
NBP2-49430-25ul |
25 μL |
£240.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
AMPK alpha 1 Polyclonal antibody specifically detects AMPK alpha 1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| AMPK alpha 1 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, Autophagy, Cancer, Hypoxia, MAP Kinase Signaling, mTOR Pathway, Signal Transduction, Translation Control | |
| PBS (pH 7.2), 40% Glycerol | |
| 5562 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| AMP -activate kinase alpha 1 subunit, AMP-activated protein kinase, catalytic, alpha-1,5'-AMP-activated protein kinase catalytic subunit alpha-1, AMPK, AMPK alpha 1,5'-AMP-activated protein kinase, catalytic alpha-1 chain, AMPK subunit alpha-1, AMPK1, AMPKa1, EC 2.7.11, EC 2.7.11.1, MGC33776, MGC57364, protein kinase, AMP-activated, alpha 1 catalytic subunit | |
| This antibody was developed against a recombinant protein corresponding to amino acids: NEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKA | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title